PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG003783.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 316aa    MW: 35600.5 Da    PI: 8.5053
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG003783.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox629.3e-2065126157
                  TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  r++R+++t+eql +Lee +    r+p+++++++++++l    +++ ++V++WFqN++a+e++
  CCG003783.1  65 RSSRWNPTAEQLLALEEQYSCgVRTPTTNQIQQITSELrrfgKIEGKNVFYWFQNHKARERQ 126
                  689*****************99**************************************97 PP

2Wus_type_Homeobox107.48.7e-3565128265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ++RW+Pt+eQ+  Lee y++G+rtP++++iq+it+eL+++Gkie+kNVfyWFQN+kaRerqk+
        CCG003783.1  65 RSSRWNPTAEQLLALEEQYSCGVRTPTTNQIQQITSELRRFGKIEGKNVFYWFQNHKARERQKR 128
                        579***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.28962127IPR001356Homeobox domain
SMARTSM003892.1E-464131IPR001356Homeobox domain
PfamPF000462.1E-1765126IPR001356Homeobox domain
CDDcd000865.38E-465128No hitNo description
SuperFamilySSF466892.28E-1065129IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-767126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MWMINGGDSN EPSMNDCFNP KPNTTTPCTN TTATPLTYVG LKHHLAKTSE QSRGRKLKEQ  60
AEATRSSRWN PTAEQLLALE EQYSCGVRTP TTNQIQQITS ELRRFGKIEG KNVFYWFQNH  120
KARERQKRRQ GQQKHKNSDH ESSNKMKESG PRRTVLGVDQ TNNLAPHSKC STDHVEGPVS  180
VNGAALAESG THGWSEFEER ELQQMKSISL DMHAMWQTMD LSSSTPVHRL TSNMTTTASK  240
FSSLEEHSSL LRPTKTATHA NHDGEIREVQ TLQLFPLCSD DANGANGTNN DRNVPIRTIN  300
TTFTPSQFFE FLPLKN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121129ARERQKRRQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827070.0KF982707.1 Populus tomentosa WOX6 (WOX6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011038631.10.0PREDICTED: WUSCHEL-related homeobox 6
TrEMBLB9HW560.0B9HW56_POPTR; Uncharacterized protein
STRINGPOPTR_0010s12150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.13e-24WOX family protein